PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00868.1.p
Common NameEUGRSUZ_I00868
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 211aa    MW: 24081.5 Da    PI: 6.5053
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00868.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR165.81.1e-2040127391
              FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                       Y +YA   GF vrk +  ++ +++++t+rtfvC++eg++ ++++++++++ +r   r+gC a++k k ++++++ev++ ++eHnH+++p
  Eucgr.I00868.1.p  40 YVAYAIIKGFGVRKGSLVRN-TKRKVTRRTFVCNCEGYSINSSDEEKEKKFERFDIRCGCLAHIKFKVDNNDVFEVIEYNSEHNHAFVP 127
                       99****************99.5556***************99999999999**********************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-1840127IPR004330FAR1 DNA binding domain
PfamPF029902.7E-7142189IPR004240Nonaspanin (TM9SF)
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MAESELETSH LVHVMRDMEK DFEFAIGMVF SNELEAYNKY VAYAIIKGFG VRKGSLVRNT  60
KRKVTRRTFV CNCEGYSINS SDEEKEKKFE RFDIRCGCLA HIKFKVDNND VFEVIEYNSE  120
HNHAFVPENQ RHMIRCGRIM SETCKGVLEV ACAKKLTSEE VSQIQAAIKQ FYIFQMYCDD  180
LPIWGYKGKV TNEAQGENVL FGDVGAIPGN *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00868.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028196.15e-87PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028197.15e-87PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028199.15e-87PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028200.15e-87PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028201.15e-87PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028202.15e-87PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028203.15e-87PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLA0A059ANC41e-157A0A059ANC4_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1499737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.28e-09FAR1 family protein